Active human CXCL11 full length protein

• Supplier: Abcam
• Catalog: ab191755
• Category: Protein
• Prices: $192.00
• Sizes: 20 µg
• Applications: SDS-PAGE FA
• Species Reactivities: Human
• Nature: Recombinant
• Source: E. coli
• Purity: >95% by SDS-PAGE .
• Bioactivity: Determined by its ability to chemoattract Human T cells using a concentration range of 2.0-10.0 ng/ml.
• Endotoxin: < 1.000 Eu/µg
• SwissProt/Accession: O14625
• Gene: CXCL11
• Residue: 22 to 94
• Sequence: FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKG QRCLNPKSKQARLIIKKVERKNF