Recombinant Human HGD Protein

Name Recombinant Human HGD Protein
Supplier Novus Biologicals
Catalog H00003081-Q01
Category Protein
Prices $369.00, $529.00
Sizes 10 µg, 25 µg
Applications WB ELISA Array
Species Reactivities Human
Nature Recombinant
Source Wheat Germ
Bioactivity This protein is not active and should not be used for experiments requiring activity.
Gene HGD
Sequence CFEKASKVKLAPERIADGTMAFMFESSLSLAVTKWGLKASRCLDENYHKCWEPLKSHFTPNSRNPAEPN
Description HGD (Human) GST-Tagged Recombinant Protein (Q01) Source: Wheat Germ (in vitro) Amino Acid Sequence: CFEKASKVKLAPERIADGTMAFMFESSLSLAVTKWGLKASRCLDENYHKCWEPLKSHFTPNSRNPAEPN
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.