Active human Cyclophilin A full length protein
| Name | Active human Cyclophilin A full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab181969 |
| Category | Protein |
| Prices | $186.00 |
| Sizes | 100 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag C-Terminus |
| Purity | > 92 % by SDS-PAGE. |
| Bioactivity | Measured by the ability of ab181969 to inhibit calcineurin phosphatase activity in the presence of Cyclosporin A. The IC 50 for inhibition of calcineurin activity is less than 400 nM. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P62937 |
| Gene | PPIA |
| Residue | 1 to 165 |
| Sequence | MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKG SCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSM ANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNG KTSKKITIADCGQLE |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of DTT-reduced ab181969 stained overnight with Coomassie Blue. DTT-reduced protein migrates as 17-20 kDa.