Active human Cyclophilin A full length protein

Name Active human Cyclophilin A full length protein
Supplier Abcam
Catalog ab86219
Category Protein
Prices $200.00, $939.00
Sizes 100 µg, 500 µg
Applications FA SDS-PAGE
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity > 95 % by SDS-PAGE. purified by using conventional chromatography techniques.
Bioactivity Specific activity is > 270 nmoles/min/mg, and is defined as the amount of enzyme that cleaves 1 µmole of suc-AAFP-pNA per minute at 25°C in Tris-Hcl pH8.0 using chymotrypsin. Activity Assay Prepare 170 µl assay buffer into a suitable container and pre-chill on ice before use: The final concentrations are 200 mM Tris-Hcl, pH 8.0, and 20nM chymotrypsin. Add 10 µl of recombinant Cyclophilin A protein with 1 µg in assay buffer. Mix by inversion and equilibrate to 1°C and monitor the A405nm until the value is constant using a spectrophotometer. Add 20 µl pre-chilled 5mM suc-AAFP-pNA. (Substrate was dissolved in TFE that contained 460mM LiCl to a concentration of 3 mM) Record the increase in A405 nm for 30 minutes at 25°C.
Endotoxin < 1.000 Eu/µg
SwissProt/Accession P62937
Gene PPIA
Sequence MGSSHHHHHHSSGLVPRGSHMVNPTVFFDIAVDGEPLGRVSFELFADKVP KTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYG EKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFG KVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
Supplier Page Shop

Product images