Name | Recombinant Human MKRN3 Protein |
---|---|
Supplier | Novus Biologicals |
Catalog | H00007681-Q01 |
Category | Protein |
Prices | $369.00, $529.00 |
Sizes | 10 µg, 25 µg |
Applications | WB ELISA Array |
Species Reactivities | Human |
Nature | Recombinant |
Source | Wheat Germ |
Bioactivity | This protein is not active and should not be used for experiments requiring activity. |
Gene | MKRN3 |
Sequence | SFSAYWHQLVEPVRMGEGNMLYKSIKKELVVLRLASLLFKRFLSLRDELPFSEDQWDLLHYELEEYFNLIL |
Description | MKRN3 (Human) GST-Tagged Recombinant Protein (Q01) Source: Wheat Germ (in vitro) Amino Acid Sequence: SFSAYWHQLVEPVRMGEGNMLYKSIKKELVVLRLASLLFKRFLSLRDELPFSEDQWDLLHYELEEYFNLIL |
Supplier Page | Shop |