Recombinant Human IRF2 Protein
| Name | Recombinant Human IRF2 Protein |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBC1-18476 |
| Category | Protein |
| Prices | $349.00 |
| Sizes | 100 µg |
| Applications | SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Purity | >95% pure by SDS-PAGE |
| Endotoxin | < 1.0 EU per 1 microgram of protein (determined by LAL method) |
| Gene | IRF2 |
| Sequence | MGSSHHHHHHSSGLVPRGSHMPVERMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAIHTGKHQPGVDKPDPKTWKANFRCAMNSLPDIEEVKDKSIKKGNNAFRVYRMLP |
| Description | A recombinant protein corresponding to amino acids 1 - 113 of IRF2 |
| Supplier Page | Shop |
Product images
![SDS-Page: IRF2 Protein [NBC1-18476] - IRF2, 15 kDa ( 133 aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE](http://www.bioprodhub.com/system/product_images/pp_products/5/sub_1/28751_IRF2%2520Protein-SDS-Page-NBC1-18476-img0001.jpg)
SDS-Page: IRF2 Protein [NBC1-18476] - IRF2, 15 kDa ( 133 aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE