Recombinant Bacterial Carbonic Anhydrase I/CA1 Protein
| Name | Recombinant Bacterial Carbonic Anhydrase I/CA1 Protein |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBC1-18527 |
| Category | Protein |
| Prices | $329.00 |
| Sizes | 100 µg |
| Applications | SDS-PAGE |
| Nature | Recombinant |
| Purity | >95% pure by SDS-PAGE |
| Gene | CA1 |
| Sequence | MGSSHHHHHHSSGLVPRGSHMKDIDTLISNNALWSKMLVEEDPGFFEKLAQAQKPRFLWIGCSDSRVPAERLTGLEPGELFVHRNVANLVIHTDLNCLSVVQYAVDVLEVEHIIICGHYGCGGVQAAVENPELGLINNWLLHIRDIWFKHSSLLGEMPQERRLDTLCELNVMEQVYNLGHSTIMQSAWKRGQKVTIHGWAYGIHDGLLRDLDVTATNRETLEQRYRHGISNLKLKHANHK |
| Description | A recombinant protein corresponding to amino acids 1 - 220 of CA1 |
| Supplier Page | Shop |
Product images
![SDS-Page: Carbonic Anhydrase I Protein [NBC1-18527] - Carbonic anhydrase, 27kDa (240aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE](http://www.bioprodhub.com/system/product_images/pp_products/5/sub_1/29370_Carbonic%2520Anhydrase%2520I%2520Protein-SDS-Page-NBC1-18527-img0001.jpg)
SDS-Page: Carbonic Anhydrase I Protein [NBC1-18527] - Carbonic anhydrase, 27kDa (240aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE