Recombinant Human FABP8/M-FABP/Myelin P2 Protein Protein

Name Recombinant Human FABP8/M-FABP/Myelin P2 Protein Protein
Supplier Novus Biologicals
Catalog NBC1-18345
Category Protein
Prices $349.00
Sizes 100 µg
Applications SDS-PAGE
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >95% pure by SDS-PAGE
Gene PMP2
Sequence MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV
Description A recombinant protein corresponding to amino acids 1 - 132 of PMP2
Supplier Page Shop

Product images