Recombinant Human FABP1/L-FABP Protein
| Name | Recombinant Human FABP1/L-FABP Protein |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBC1-18503 |
| Category | Protein |
| Prices | $299.00, $750.00 |
| Sizes | 100 µg, 500 µg |
| Applications | SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Purity | >95% pure by SDS-PAGE |
| Endotoxin | < 1.0 EU per 1 microgram of protein (determined by LAL method) |
| Gene | FABP1 |
| Sequence | MGSSHHHHHHSSGLVPRGSHMSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI |
| Description | A recombinant protein containing a His-tag corresponding to amino acids: 1 - 127 of FABP1 |
| Supplier Page | Shop |
Product images
![SDS-Page: FABP1/L-FABP Protein [NBC1-18503] - FABP1, 16kDa (147aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE](http://www.bioprodhub.com/system/product_images/pp_products/5/sub_1/20047_FABP1-L-FABP-Protein-SDS-Page-NBC1-18503-img0002.jpg)
SDS-Page: FABP1/L-FABP Protein [NBC1-18503] - FABP1, 16kDa (147aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE