Recombinant Human VAMP-1 Protein
| Name | Recombinant Human VAMP-1 Protein |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBC1-18336 |
| Category | Protein |
| Prices | $269.00 |
| Sizes | 100 µg |
| Applications | SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% pure by SDS-PAGE |
| Gene | VAMP1 |
| Sequence | MGSSHHHHHHSSGLVPRGSHMSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYW |
| Description | A recombinant protein with a His tag and corresponding to amino acids 1 - 91 of VAMP1 |
| Supplier Page | Shop |
Product images
![SDS-Page: Recombinant Human VAMP-1 Protein [NBC1-18336] - Synaptobrevin1, 11.9 kDa (111 aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE](http://www.bioprodhub.com/system/product_images/pp_products/5/sub_1/20253_Recombinant-Human-VAMP-1-Protein-SDS-Page-NBC1-18336-img0003.jpg)
SDS-Page: Recombinant Human VAMP-1 Protein [NBC1-18336] - Synaptobrevin1, 11.9 kDa (111 aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE