Recombinant Human FGF-12 Protein

Name Recombinant Human FGF-12 Protein
Supplier Novus Biologicals
Catalog NBC1-18495
Category Protein
Prices $499.00
Sizes 100 µg
Applications SDS-PAGE
Species Reactivities Human
Nature Recombinant
Purity >90%, by SDS-PAGE
Endotoxin < 1.0 EU per 1 microgram of protein (determined by LAL method)
Gene FGF12
Sequence MGSSHHHHHHSSGLVPRGSHMESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREQSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST
Description A recombinant protein corresponding to amino acids 1 - 181 of FGF12
Supplier Page Shop

Product images