Recombinant Human KIR3DL1 Protein
| Name | Recombinant Human KIR3DL1 Protein |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBC1-18413 |
| Category | Protein |
| Prices | $349.00 |
| Sizes | 100 µg |
| Applications | SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Purity | >95% pure by SDS-PAGE |
| Gene | KIR3DL1 |
| Sequence | MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSTSGTIDKLDIEFHLWCSNKKNAAVMDQEPAGNRTANSEDSDEQDPEEVTYAQLDHCVFTQRKITRPSQRPKTPPTDTILYTELPNAKPRSKVVSCP |
| Description | A recombinant protein corresponding to amino acids 361 - 444 of KIR3DL1 |
| Supplier Page | Shop |
Product images
![SDS-Page: KIR3DL1 Protein [NBC1-18413] - KIR3DL1, 15 kDa (132 aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE](http://www.bioprodhub.com/system/product_images/pp_products/5/sub_1/29128_KIR3DL1%2520Protein-SDS-Page-NBC1-18413-img0001.jpg)
SDS-Page: KIR3DL1 Protein [NBC1-18413] - KIR3DL1, 15 kDa (132 aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE