Human CD20 protein fragment
| Name | Human CD20 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab168701 |
| Category | Protein |
| Prices | $402.00 |
| Sizes | 100 µg |
| Applications | SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | >95% by SDS-PAGE . ab168701 is lyophilized from 0.22 µm filtered solution. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P11836 |
| Gene | MS4A1 |
| Residue | 141 to 184 |
| Sequence | IKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCY |
| Supplier Page | Shop |
Product images
SDS PAGE analysis of ab168701 under reduced conditions and stained overnight with Coomassie Blue.