Human CD38 protein fragment
| Name | Human CD38 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab112266 |
| Category | Protein |
| Prices | $402.00 |
| Sizes | 10 µg |
| Applications | SDS-PAGE Array WB ELISA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Bioactivity | useful for Antibody Production and Protein Array |
| SwissProt/Accession | P28907 |
| Gene | CD38 |
| Residue | 201 to 300 |
| Sequence | CDVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEAWVIHGGREDS RDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSCTSEI |
| Supplier Page | Shop |
Product images
12.5% SDS-PAGE Stained with Coomassie Blue.