Human CD3D protein fragment
| Name | Human CD3D protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab167701 |
| Category | Protein |
| Prices | $402.00 |
| Sizes | 100 µg |
| Applications | SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Tag/Conjugation | His tag C-Terminus |
| Purity | >95% by SDS-PAGE . |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P04234 |
| Gene | CD3D |
| Residue | 22 to 105 |
| Sequence | FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIY RCNGTDIYKDKESTVQVHYRMCQSCVELDPATVA |
| Supplier Page | Shop |
Product images
SDS-PAGE of reduced ab167701 stained overnight with Coomassie Blue. DTT-reduced protein migrates as 18-25 kDa polypeptide in SDS-PAGE resulting from different glycosylation.