Human CD9 protein fragment
| Name | Human CD9 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab174040 |
| Category | Protein |
| Prices | $406.00 |
| Sizes | 20 µg |
| Applications | SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Tag/Conjugation | His tag C-Terminus |
| Purity | >95% by SDS-PAGE . |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P21926 |
| Gene | CD9 |
| Residue | 112 to 195 |
| Sequence | SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQ FISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of Human CD9 in reducing conditions. Gel stained overnight with Coomassie Blue. Protein migrates at 11 kDa.