Human CD99 protein fragment
| Name | Human CD99 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab174036 |
| Category | Protein |
| Prices | $406.00 |
| Sizes | 100 µg |
| Applications | SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | > 92 % by SDS-PAGE. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P14209 |
| Gene | CD99 |
| Residue | 23 to 122 |
| Sequence | DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNP PKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEAD |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of reduced ab174036 and staining overnight with Coomassie Blue. DTT-reduced Protein migrates as 45-50 kDa due to glycosylation.