Recombinant Human Betacellulin/BTC Protein

• Supplier: Novus Biologicals
• Catalog: NBP1-99876
• Category: Protein
• Prices: $195.00
• Sizes: 20 µg
• Species Reactivities: Human
• Nature: Recombinant
• Source: E. coli
• Purity: SDS-PAGE
• Bioactivity: Biological Activity: The ED50, calculated by the dose-dependant proliferation of murine BALB\C 3T3 cells (measured by 3H-thymidine uptake) is < 0.05 ng/ml; corresponding to a Specific Activity of > 2.0 x10^7IU/mg.
• Gene: BTC
• Sequence: DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVA EQTPSCVCDEGYIGARCERVDLFY
• Description: A recombinant protein corresponding to 80 amino acids of Human Betacellulin/BTC Source: E. coli Amino Acid Sequence: DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVA EQTPSCVCDEGYIGARCERVDLFY Purity by SDS-PAGE: >97%