Recombinant Human Guanylate kinase Protein
| Name | Recombinant Human Guanylate kinase Protein |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-48340 |
| Category | Protein |
| Prices | $269.00, $729.00 |
| Sizes | 100 µg, 500 µg |
| Applications | SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >90%, by SDS-PAGE |
| Gene | GUK1 |
| Sequence | MGSSHHHHHHSSGLVPRGSHMSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA |
| Description | A recombinant protein with a His tag and corresponding to amino acids 1 - 197 of GUK1 |
| Supplier Page | Shop |
Product images
![SDS-Page: Guanylate kinase Protein [NBP1-48340]](http://www.bioprodhub.com/system/product_images/pp_products/5/sub_1/28718_Guanylate-kinase-Protein-SDS-Page-NBP1-48340-img0001.jpg)
SDS-Page: Guanylate kinase Protein [NBP1-48340]