Recombinant Human HIF-1 alpha Protein
| Name | Recombinant Human HIF-1 alpha Protein |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-49165 |
| Category | Protein |
| Prices | $269.00, $729.00 |
| Sizes | 10 µg, 50 µg |
| Applications | SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Gene | HIF1A |
| Sequence | MGSSHHHHHHSSGLVPRGSHMEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVMRLTISYLRVRKLLDAGDLDIEDDMK |
| Description | A recombinant protein with a His tag and corresponding to amino acids 1 - 85 of HIF1A. Source: E. coli Amino Acid Sequence: MGSSHHHHHHSSGLVPRGSHMEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVMRLTISYLRVRKLLDAGDLDIEDDMK |
| Supplier Page | Shop |
Product images
![Recombinant Human HIF-1 alpha Protein [NBP1-49165]](http://www.bioprodhub.com/system/product_images/pp_products/5/sub_1/21443_Recombinant-Human-HIF-1-alpha-Protein-NBP1-49165-img0001.jpg)
Recombinant Human HIF-1 alpha Protein [NBP1-49165]