Recombinant Human PSMG3 Protein

Name Recombinant Human PSMG3 Protein
Supplier Novus Biologicals
Catalog NBP1-49303
Category Protein
Prices $269.00, $729.00
Sizes 10 µg, 50 µg
Applications SDS-PAGE
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >90%, by SDS-PAGE
Gene PSMG3
Sequence MGSSHHHHHHSSGLVPRGSHMEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW
Description A recombinant protein with a His tag and corresponding to amino acids 1 - 122 of PSMG3
Supplier Page Shop