Recombinant Human THYN1 Protein

Name Recombinant Human THYN1 Protein
Supplier Novus Biologicals
Catalog NBP1-49448
Category Protein
Prices $269.00, $729.00
Sizes 100 µg, 500 µg
Applications SDS-PAGE
Species Reactivities Human
Nature Recombinant
Purity >95% pure by SDS-PAGE
Gene THYN1
Sequence MGSSHHHHHHSSGLVPRGSHMSRPRKRLAGTSGSDKGLSGKRTKTENSGEALAKVEDSNPQKTSATKNCLKNLSSHWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFYHSNCKEPGIAGLMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPLKNMVLFTRQRLSIQPLTQEEFDFVLSLEEKEPS
Description A recombinant protein corresponding to amino acids 1 - 225 of THYN1
Supplier Page Shop