Active human Eotaxin full length protein
| Name | Active human Eotaxin full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab194164 |
| Category | Protein |
| Prices | $176.00 |
| Sizes | 4 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Cell Culture |
| Tag/Conjugation | StrepII tag C-Terminus |
| Purity | = 80 % by SDS-PAGE. Chemically-defined, serum- and animal-product-free culture medium |
| Bioactivity | ED 50 is 0.01-0.1 ng/ml as determined by a HEK293 cell proliferation assay. |
| Endotoxin | < 0.100 Eu/µg |
| SwissProt/Accession | P51671 |
| Gene | CCL11 |
| Residue | 24 to 97 |
| Sequence | GPASVPTTCCFNLANRKIPLQRLESYRRITSGKCPQKAVIFKTKLAKDIC ADPKKKWVQDSMKYLDQKSPTPKP |
| Supplier Page | Shop |
