| Name | Active human Eotaxin full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab192105 |
| Category | Protein |
| Prices | $192.00 |
| Sizes | 20 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Activity was determined by the ability to induce chemotaxis of purified eosinophils at concentrations ranging between 50-100 ng/mL. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P51671 |
| Gene | CCL11 |
| Residue | 24 to 97 |
| Sequence | GPASVPTTCCFNLANRKIPLQRLESYRRITSGKCPQKAVIFKTKLAKDIC ADPKKKWVQDSMKYLDQKSPTPKP |
| Supplier Page | Shop |