CART (55-102) (human)

• Supplier: R&D Systems
• Catalog: 3338
• Category: Peptide
• Prices: $235.00
• Sizes: 100 µg
• Species Reactivities: Human
• Gene: CARTPT
• Sequence: VPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL (Modifications: Disulfide bridge between 14 - 32, 20 - 40, 34 - 47)
• Description: Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry