Active human EPO full length protein
| Name | Active human EPO full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab155618 |
| Category | Protein |
| Prices | $239.00 |
| Sizes | 10 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | The bio-activity was determined by dose-dependent stimulation of the proliferation of TF-1 cells. The ED50<0.2ng/ml, corresponding to a specific activity of not less than 1.5X10 5 IU/mg. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P01588 |
| Gene | EPO |
| Residue | 28 to 193 |
| Sequence | APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA WKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVS GLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLR GKLKLYTGEACRTGDR |
| Supplier Page | Shop |
Product images
Purity of ab155618 determined by SDS-PAGE analysis under reduced conditions, and stained overnight with Coomassie Blue.