Human Chromosome X open reading frame 6 protein fragment
| Name | Human Chromosome X open reading frame 6 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab160781 |
| Category | Protein |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Tag/Conjugation | proprietary tag N-Terminus |
| Gene | MAMLD1 |
| Residue | 603 to 701 |
| Sequence | SPSNITHVDKACKLGEARHPQVSLGRQPPSCQALGSESFLPGSSFAHELA RVTSSYSTSEAAPWGSWDPKAWRQVPAPLLPSCDATARGTEIRSYGNDP |
| Supplier Page | Shop |
Product images
ab160781 on a 12.5% SDS-PAGE stained with Coomassie Blue.