CCNJL fusion protein

Name CCNJL fusion protein
Supplier Proteintech Group
Catalog Ag25048
Category Protein
Prices $199.00
Sizes 50 μg
Species Reactivities Human
Source E. coli -derived, PGEX-4T
Tag/Conjugation gst
Purity 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Bioactivity Not tested.
Endotoxin Please contact the lab for more information.
Gene CCNJL
Sequence PALGQPATTLAQFQTPVQDLCLAYRDSLQAHRS (20 - 52 aa encoded by BC013353 )
Supplier Page Shop

Product images