Human Claudin 2 protein fragment
| Name | Human Claudin 2 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab112383 |
| Category | Protein |
| Applications | WB SDS-PAGE ELISA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Bioactivity | Useful for Antibody Production and Protein Array |
| SwissProt/Accession | P57739 |
| Gene | CLDN2 |
| Residue | 29 to 80 |
| Sequence | SWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQ AA |
| Supplier Page | Shop |
Product images
ab112383 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.