Human Claudin 4 protein fragment
| Name | Human Claudin 4 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab112274 |
| Category | Protein |
| Applications | SDS-PAGE WB ELISA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | O14493 |
| Gene | CLDN4 |
| Residue | 29 to 78 |
| Sequence | MWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQ |
| Supplier Page | Shop |
Product images
12.5% SDS-PAGE showing ab112274 at approximately 31.13kDa stained with Coomassie Blue.