| Name | Active human EREG full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab191724 |
| Category | Protein |
| Prices | $192.00 |
| Sizes | 25 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | The ED 50 determined by a cell proliferation assay using balb/c 3T3 cells is ≤ 0.1 ng/ml, corresponding to a specific activity of ≥ 5.0 x 10 5 units/mg. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | O14944 |
| Gene | EREG |
| Residue | 60 to 108 |
| Sequence | VAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFL |
| Supplier Page | Shop |