| Name | Active human EREG full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab116471 |
| Category | Protein |
| Prices | $210.00 |
| Sizes | 5 µg |
| Applications | SDS-PAGE HPLC FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | > 97 % by SDS-PAGE. ab116471 is purified by proprietary chromatographic techniques. Purity is greater than 97.0% as determined by RP-HPLC and SDS-PAGE. |
| Bioactivity | The ED 50 was determined by the dose-dependent stimulation of the proliferation of murine Balb/3T3 cells is < 2.0 ng/ml, corresponding to a specific activity of > 500,000 units/mg. |
| SwissProt/Accession | O14944 |
| Gene | EREG |
| Residue | 60 to 108 |
| Sequence | MVAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFL |
| Supplier Page | Shop |