Active human FGF basic full length protein

Name Active human FGF basic full length protein
Supplier Abcam
Catalog ab155734
Category Protein
Prices $239.00
Sizes 200 µg
Applications FA SDS-PAGE
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity > 98 % by SDS-PAGE. ab155734 was lyophilised from 0.22 µm filtered solution.
Bioactivity Measured in a cell proliferation assay using BALB/c 3T3 mouse embryonic fibroblasts. The ED 50 for this effect is typically 0.02 - 0.1 ng/ml.
Endotoxin < 1.000 Eu/µg
SwissProt/Accession P09038
Gene FGF2
Residue 143 to 288
Sequence PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPH IKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLES NNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Supplier Page Shop

Product images