Name | Active human FGF basic full length protein |
---|---|
Supplier | Abcam |
Catalog | ab155734 |
Category | Protein |
Prices | $239.00 |
Sizes | 200 µg |
Applications | FA SDS-PAGE |
Species Reactivities | Human |
Nature | Recombinant |
Source | E. coli |
Purity | > 98 % by SDS-PAGE. ab155734 was lyophilised from 0.22 µm filtered solution. |
Bioactivity | Measured in a cell proliferation assay using BALB/c 3T3 mouse embryonic fibroblasts. The ED 50 for this effect is typically 0.02 - 0.1 ng/ml. |
Endotoxin | < 1.000 Eu/µg |
SwissProt/Accession | P09038 |
Gene | FGF2 |
Residue | 143 to 288 |
Sequence | PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPH IKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLES NNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Supplier Page | Shop |