Active human FGF basic full length protein
| Name | Active human FGF basic full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab88394 |
| Category | Protein |
| Prices | $410.00 |
| Sizes | 5 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | > 95 % by SDS-PAGE. |
| Bioactivity | Activity: The ED 50 of ab88394 is typically 0.05-0.1 ng/ml as measured in a cell proliferation assay using human umbilical endothelial cells (HUVECs). |
| SwissProt/Accession | P09038 |
| Gene | FGF2 |
| Sequence | MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVD GVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVT DE CFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAI LFLP MSAKS |
| Supplier Page | Shop |
Product images
1D SDS-PAGE of ab88394 before and after treatment with glycosidases to remove oligosaccharides. Lane 1: ab88394 Lane 2: ab88394 treated with PNGase F to remove potential N-linked glycans Lane 3: ab88394 treated with a glycosidase cocktail to remove potential N- and O-linked glycans. Additional bands in lane 2 and lane 3 are glycosidase enzymes. The results suggest that ab88394 is not glycosylated.