Human CRIP1 full length protein
| Name | Human CRIP1 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab171471 |
| Category | Protein |
| Applications | SDS-PAGE MS |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag N-Terminus |
| Purity | >95% by SDS-PAGE . ab171471 is purified using conventional chromatography techniques. |
| SwissProt/Accession | P50238 |
| Gene | CRIP1 |
| Residue | 1 to 77 |
| Sequence | MGSSHHHHHHSSGLVPRGSHMGSMPKCPKCNKEVYFAERVTSLGKDWHRP CLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK |
| Supplier Page | Shop |
Product images
15% SDS-PAGE analysis of 3µg ab171471.