Recombinant MIP-3 α/CCL20, Rat

Name Recombinant MIP-3 α/CCL20, Rat
Supplier Bioworld Technology
Catalog BK0324~25
Category Protein
Prices $598.00
Sizes 25 μg
Species Reactivities Rat
Nature Recombinant
Source HEK 293
Purity > 98% as analyzed by SDS-PAGE.
Bioactivity The EC50 value of rat MIP-3 α/CCL20 on Caˆ2+ mobilization assay in CHO-K1/ G15/rCCR6 cells (human G15 and rat CCR6 stably expressed in CHO-K1 cells) is less than 0.6 μg/ml.
Endotoxin < 0.2 EU/μg, determined by LAL method.
Gene Ccl20
Sequence ASNFDCCLTYTKNVYHHARNFVGFTTQMADEACDINAIIFHLKSKRSVCADPKQIWVKRIL HLLSLRTKKM
Supplier Page Shop