| Name | Recombinant MIP-3 α/CCL20, Rat |
|---|---|
| Supplier | Bioworld Technology |
| Catalog | BK0324~5 |
| Category | Protein |
| Prices | $198.00 |
| Sizes | 5 μg |
| Species Reactivities | Rat |
| Nature | Recombinant |
| Source | HEK 293 |
| Purity | > 98% as analyzed by SDS-PAGE. |
| Bioactivity | The EC50 value of rat MIP-3 α/CCL20 on Caˆ2+ mobilization assay in CHO-K1/ G15/rCCR6 cells (human G15 and rat CCR6 stably expressed in CHO-K1 cells) is less than 0.6 μg/ml. |
| Endotoxin | < 0.2 EU/μg, determined by LAL method. |
| Gene | Ccl20 |
| Sequence | ASNFDCCLTYTKNVYHHARNFVGFTTQMADEACDINAIIFHLKSKRSVCADPKQIWVKRIL HLLSLRTKKM |
| Supplier Page | Shop |