Human CSAG1 full length protein
| Name | Human CSAG1 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab180304 |
| Category | Protein |
| Applications | SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag N-Terminus |
| Purity | >90% by SDS-PAGE. ab180304 was purified by using conventional chromatography techniques. |
| SwissProt/Accession | Q6PB30 |
| Gene | CSAG1 |
| Residue | 20 to 78 |
| Sequence | MGSSHHHHHHSSGLVPRGSHMGSDQVDWSRLYRDTGLVKMSRKPRASSPF SNNHPSTPKRFPRQPKREKGPVKEVPGTKGSP |
| Supplier Page | Shop |
Product images
15% SDS-PAGE analysis of ab180304 (3 µg).