Human CXCR4 protein fragment
| Name | Human CXCR4 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab155716 |
| Category | Protein |
| Applications | SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | >95% by SDS-PAGE . |
| Endotoxin | < 0.100 Eu/µg |
| SwissProt/Accession | P61073 |
| Gene | CXCR4 |
| Residue | 1 to 46 |
| Sequence | MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYS |
| Supplier Page | Shop |
Product images
SDS-PAGE of reduced ab155716 stained overnight with Coomassie Blue.