Human Cystatin SA full length protein

Name Human Cystatin SA full length protein
Supplier Abcam
Catalog ab151355
Category Protein
Applications SDS-PAGE HPLC
Species Reactivities Human
Nature Recombinant
Source HEK 293 cells
Tag/Conjugation His tag C-Terminus
Purity >95% by SDS-PAGE . The peurity of ab151355 is greater than 95%, as determined by SEC-HPLC and reducing SDS-PAGE. It is lyophilized from a 0.2 µM filtered solution.
Endotoxin < 1.000 Eu/µg
SwissProt/Accession P09228
Gene CST2
Residue 21 to 141
Sequence WSPQEEDRIIEGGIYDADLNDERVQRALHFVISEYNKATEDEYYRRLLRV LRAREQIVGGVNYFFDIEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSF QIYEVPWEDRMSLVNSRCQEAVDHHHHHH
Supplier Page Shop