Human D Box Binding Protein protein fragment
| Name | Human D Box Binding Protein protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab158263 |
| Category | Protein |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Tag/Conjugation | proprietary tag N-Terminus |
| SwissProt/Accession | Q10586 |
| Gene | DBP |
| Residue | 226 to 325 |
| Sequence | RRHRFSEEELKPQPIMKKARKIQVPEEQKDEKYWSRRYKNNEAAKRSRDA RRLKENQISVRAAFLEKENALLRQEVVAVRQELSHYRAVLSRYQAQHGAL |
| Supplier Page | Shop |
Product images
ab158263 on a 12.5% SDS-PAGE stained with Coomassie Blue.