Active human Flt3 ligand protein fragment
| Name | Active human Flt3 ligand protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab169056 |
| Category | Protein |
| Prices | $352.00 |
| Sizes | 100 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Tag/Conjugation | His tag C-Terminus |
| Purity | >95% by SDS-PAGE . Lyophilized from 0.22 µm filtered solution. |
| Bioactivity | Measured by its binding ability in a functional ELISA. When Folic AcidBovine Serum Albumin was coated at 5 µg/ml (100 µl/well), the concentration of rhFOLR2 that produces 50% of the optimal binding response was found to be approximately 0.15-1.1 nM. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P49771 |
| Gene | FLT3LG |
| Residue | 17 to 228 |
| Sequence | TMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQ ELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQ SWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAG ALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPN EEVARFYAAAMH |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of reduced Human Flt3 ligand protein. Stained overnight with Coomassie Blue.