Active human Flt3 ligand protein fragment
| Name | Active human Flt3 ligand protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab168905 |
| Category | Protein |
| Prices | $192.00 |
| Sizes | 10 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Tag/Conjugation | His tag C-Terminus |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | The specific activity was determined by the dose dependent stimulation of the proliferation of the Human acute myeloid leukemia cell line OCI-AML5. The ED 50 for this effect is typically 0.1-0.5 ng/ml. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P49771 |
| Gene | FLT3LG |
| Residue | 27 to 185 |
| Sequence | TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRL VLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTN ISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEA TAPTAPQPP |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of ab168905 stained overnight with Coomassie Blue.