MOCS2 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: ISSSCFSLETKLPLSPPLVEDSAFEPSRKDMDEVEEKSKDVINFTAEKLSVDEVSQLVISPLCGAISL |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MOCS2 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for MOCS2 Antibody - BSA Free
Background
Eukaryotic molybdoenzymes use a unique molybdenum cofactor (MoCo) consisting of a pterin, termed molybdopterin, and the catalytically active metal molybdenum. MoCo is synthesized from precursor Z by the heterodimeric enzyme molybdopterin synthase. The large and small subunits of molybdopterin synthase are both encoded from this gene by overlapping open reading frames. The proteins were initially thought to be encoded from a bicistronic transcript. They are now thought to be encoded from monocistronic transcripts. Alternatively spliced transcripts have been found for this locus that encode the large and small subunits. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ye
Applications: ELISA, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Ch
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IHC, KO, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
Publications for MOCS2 Antibody (NBP1-81045) (0)
There are no publications for MOCS2 Antibody (NBP1-81045).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MOCS2 Antibody (NBP1-81045) (0)
There are no reviews for MOCS2 Antibody (NBP1-81045).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MOCS2 Antibody (NBP1-81045) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MOCS2 Products
Research Areas for MOCS2 Antibody (NBP1-81045)
Find related products by research area.
|
Blogs on MOCS2
![Western Blot: MOCS2 Antibody [NBP1-81045] - Analysis in control (vector only transfected HEK293T lysate) and MOCS2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/MOCS2-Antibody-Western-Blot-NBP1-81045-img0007.jpg "Western Blot: MOCS2 Antibody [NBP1-81045] - Analysis in control (vector only transfected HEK293T lysate) and MOCS2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunocytochemistry/Immunofluorescence: MOCS2 Antibody [NBP1-81045] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.](http://images.novusbio.com/fullsize/MOCS2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81045-img0006.jpg "Immunocytochemistry/Immunofluorescence: MOCS2 Antibody [NBP1-81045] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.")
![Immunohistochemistry-Paraffin: MOCS2 Antibody [NBP1-81045] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/MOCS2-Antibody-Immunohistochemistry-Paraffin-NBP1-81045-img0005.jpg "Immunohistochemistry-Paraffin: MOCS2 Antibody [NBP1-81045] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.")
![Western Blot Aldehyde Oxidase 1/AOX1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aldehyde_Oxidase_1_AF5928_Western_Blot_5882.jpg)
![Immunohistochemistry Aldehyde Oxidase 1/AOX1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aldehyde_Oxidase_1_AF5928_Immunohistochemistry_19616.jpg)
![Immunocytochemistry Aldehyde Oxidase 1/AOX1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aldehyde_Oxidase_1_AF5928_Immunocytochemistry__Immunofluorescence_19724.jpg)
![HAI-2/SPINT2 Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "HAI-2/SPINT2 Antibody [Unconjugated]")
![Immunocytochemistry HGFR/c-MET Antibody [Unconjugated]](https://images.novusbio.com/images2/HGF_R_AF276_Immunocytochemistry__Immunofluorescence_21675.jpg)
![Immunohistochemistry HGFR/c-MET Antibody [Unconjugated]](https://images.novusbio.com/images2/HGF_R_AF276_Immunohistochemistry_6763.jpg)
![Knockout Validated HGFR/c-MET Antibody [Unconjugated]](https://images.novusbio.com/images2/HGF_R_AF276_Knockout_Validated_22522.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")