PTPDC1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: GMIFSNEQQFDPLWKRRNVECLQPLTHLKRRLSYSDSDLKRAENLLEQGETPQTVPAQILVGHKPRQQKLISHCYIPQSPEPDLHKEALVRSTLSFWSQSKFGGLEGLKDNGSPIFHGRIIPKEAQQSGAFSADVSGSHSPGE |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PTPDC1 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for PTPDC1 Antibody - BSA Free
Background
PTPDC1 is encoded by this gene contains a characteristic motif of protein tyrosine phosphatases (PTPs). PTPs regulate activities of phosphoproteins through dephosphorylation. They are signaling molecules involved in the regulation of a wide variety of biological processes. The specific function of this protein has not yet been determined. Alternatively spliced transcript variants encoding distinct isoforms have been identified. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Ze
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ChIP, ICC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, KD, PA, Simple Western, WB
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: WB, ICC/IF, IHC
Publications for PTPDC1 Antibody (NBP1-81949) (0)
There are no publications for PTPDC1 Antibody (NBP1-81949).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PTPDC1 Antibody (NBP1-81949) (0)
There are no reviews for PTPDC1 Antibody (NBP1-81949).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PTPDC1 Antibody (NBP1-81949) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PTPDC1 Products
Research Areas for PTPDC1 Antibody (NBP1-81949)
Find related products by research area.
|
Blogs on PTPDC1
![Western Blot: PTPDC1 Antibody [NBP1-81949] - Analysis in control (vector only transfected HEK293T lysate) and PTPDC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/PTPDC1-Antibody-Western-Blot-NBP1-81949-img0009.jpg "Western Blot: PTPDC1 Antibody [NBP1-81949] - Analysis in control (vector only transfected HEK293T lysate) and PTPDC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunocytochemistry/Immunofluorescence: PTPDC1 Antibody [NBP1-81949] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.](http://images.novusbio.com/fullsize/PTPDC1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81949-img0007.jpg "Immunocytochemistry/Immunofluorescence: PTPDC1 Antibody [NBP1-81949] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.")
![Immunohistochemistry-Paraffin: PTPDC1 Antibody [NBP1-81949] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.](http://images.novusbio.com/fullsize/PTPDC1-Antibody-Immunohistochemistry-Paraffin-NBP1-81949-img0013.jpg "Immunohistochemistry-Paraffin: PTPDC1 Antibody [NBP1-81949] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.")
![Immunohistochemistry-Paraffin: PTPDC1 Antibody [NBP1-81949] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/PTPDC1-Antibody-Immunohistochemistry-NBP1-81949-img0008.jpg "Immunohistochemistry-Paraffin: PTPDC1 Antibody [NBP1-81949] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: PTPDC1 Antibody [NBP1-81949] - Staining of human heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.](http://images.novusbio.com/fullsize/PTPDC1-Antibody-Immunohistochemistry-Paraffin-NBP1-81949-img0010.jpg "Immunohistochemistry-Paraffin: PTPDC1 Antibody [NBP1-81949] - Staining of human heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.")
![Immunohistochemistry-Paraffin: PTPDC1 Antibody [NBP1-81949] - Staining of human cervix, uterine shows strong cytoplasmic positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/PTPDC1-Antibody-Immunohistochemistry-Paraffin-NBP1-81949-img0012.jpg "Immunohistochemistry-Paraffin: PTPDC1 Antibody [NBP1-81949] - Staining of human cervix, uterine shows strong cytoplasmic positivity in squamous epithelial cells.")
![Immunohistochemistry BMP-3b/GDF-10 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af1543_human-bmp-3b-gdf-10-affinity-purified-polyclonal-ab-immunocytochemistry-133202414504.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")