Note: Mouseover a species abbreviation on the product page to display the fullname.
Images
Genetic Strategies: Western Blot: Vang-like Protein 1/VANGL1 Antibody [NBP1-86990] - Analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-VANGL1 antibody. ...read more
Genetic Strategies: Western Blot: Vang-like Protein 1/VANGL1 Antibody [NBP1-86990] - Analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-VANGL1 antibody. ...read more
Western Blot: Vang-like Protein 1/VANGL1 Antibody [NBP1-86990] - Analysis in control (vector only transfected HEK293T lysate) and VANGL1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in ...read more
Immunocytochemistry/ Immunofluorescence: Vang-like Protein 1/VANGL1 Antibody [NBP1-86990] - Staining of MCF7 cells shows localization to plasma membrane. Antibody staining is shown in green.
Vang-like Protein 1/VANGL1 Antibody - BSA Free Summary
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DTESTYSGYSYYSSHSKKSHRQGERTRERHKSPRNKDGRGSEKSVTIQPPTGEPLLGNDSTRTEEVQDDNWGETTTAITGTSEHSISQEDIARISKDMEDSVGLDCKRY
Predicted Species
Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VANGL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Mouse reactivity reported in the scientific literature (PMID: 25837385).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for Vang-like Protein 1/VANGL1 Antibody - BSA Free
KAI1 C-terminal interacting tetraspanin
Loop-tail protein 2 homolog
LPP2
MGC5338
STB2
STB2KITENIN
STBM2
Strabismus 2
Van Gogh-like protein 1
vang (van gogh, Drosophila)-like 1, vang, van gogh-like 1 (Drosophila)
Vang like Protein 1
VANGL1
vang-like 1 (van gogh, Drosophila)
Vang-like Protein 1
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for Vang-like Protein 1/VANGL1 Antibody (NBP1-86990) (0)
There are no reviews for Vang-like Protein 1/VANGL1 Antibody (NBP1-86990).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Vang-like Protein 1/VANGL1 Antibody - BSA Free and receive a gift card or discount.
![Western Blot: Vang-like Protein 1/VANGL1 Antibody [NBP1-86990] - Analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-VANGL1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/Vang-like-Protein-1-VANGL1-Antibody-Western-Blot-NBP1-86990-img0012.jpg "Western Blot: Vang-like Protein 1/VANGL1 Antibody [NBP1-86990] - Analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-VANGL1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.")
![Western Blot: Vang-like Protein 1/VANGL1 Antibody [NBP1-86990] - Analysis in control (vector only transfected HEK293T lysate) and VANGL1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/Vang-like-Protein-1-VANGL1-Antibody-Western-Blot-NBP1-86990-img0016.jpg "Western Blot: Vang-like Protein 1/VANGL1 Antibody [NBP1-86990] - Analysis in control (vector only transfected HEK293T lysate) and VANGL1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunocytochemistry/Immunofluorescence: Vang-like Protein 1/VANGL1 Antibody [NBP1-86990] - Staining of MCF7 cells shows localization to plasma membrane. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Vang-like-Protein-1-VANGL1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86990-img0017.jpg "Immunocytochemistry/Immunofluorescence: Vang-like Protein 1/VANGL1 Antibody [NBP1-86990] - Staining of MCF7 cells shows localization to plasma membrane. Antibody staining is shown in green.")
![Western Blot BMP-1/PCP Antibody [Unconjugated]](https://images.novusbio.com/images2/BMP1_AF1927_Western_Blot_21018.jpg)
![Western Blot BMP-1/PCP Antibody [Unconjugated]](https://images.novusbio.com/images2/BMP1_AF1927_Western_Blot_21019.jpg)
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Western Blot beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Western_Blot_5100.jpg)
![Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Chromatin_Immunoprecipitation_11251.jpg)
![Simple Western beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/betaCatenin_AF1329_Simple_Western_17134.jpg)
![Immunohistochemistry Frizzled-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Frizzled-3_AF1001_Immunohistochemistry_9912.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")