Osteoadherin/OSAD/OMD Antibody - BSA Free Summary
| Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen |
Synthetic peptides corresponding to OMD(osteomodulin) The peptide sequence was selected from the middle region of OMD.
Peptide sequence LLQLHLEHNNLEEFPFPLPKSLERLLLGYNEISKLQTNAMDGLVNLTMLD. The peptide sequence for this immunogen was taken from within the described region. |
| Specificity |
This product is specific to Subunit or Isoform: 5. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
OMD |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Osteoadherin/OSAD/OMD Antibody - BSA Free
Background
OMD may be implicated in biomineralization processes. Has a function in binding of osteoblasts via the alpha(V)beta(3)-integrin.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: WB
Species: Hu, Mu
Applications: Flow, PEP-ELISA, WB
Species: Mu
Applications: WB
Species: Hu, Mu
Applications: Flow, PEP-ELISA, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: WB
Publications for Osteoadherin/OSAD/OMD Antibody (NBP1-59166) (0)
There are no publications for Osteoadherin/OSAD/OMD Antibody (NBP1-59166).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Osteoadherin/OSAD/OMD Antibody (NBP1-59166) (0)
There are no reviews for Osteoadherin/OSAD/OMD Antibody (NBP1-59166).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Osteoadherin/OSAD/OMD Antibody (NBP1-59166) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Osteoadherin/OSAD/OMD Products
Blogs on Osteoadherin/OSAD/OMD
![Western Blot: OMD Antibody [NBP1-59166] - Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.](http://images.novusbio.com/fullsize/OMD-Antibody-Western-Blot-NBP1-59166-img0003.jpg "Western Blot: OMD Antibody [NBP1-59166] - Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.")
![Immunocytochemistry RUNX2/CBFA1 Antibody (232902) [Unconjugated]](https://images.novusbio.com/images2/RUNX2_MAB2006_Immunocytochemistry_13309.jpg)
![Immunohistochemistry RUNX2/CBFA1 Antibody (232902) [Unconjugated]](https://images.novusbio.com/images/mab2006_human-runx2-cbfa1-mab-clone-232902-812025555286.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Neutralization CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/CXCL8_MAB208_Block_Neutralize_9064.jpg)
![Immunocytochemistry CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/CXCL8_MAB208_Immunocytochemistry_9339.jpg)
![Western Blot CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/mab208_human-il-8-cxcl8-mab-clone-6217-western-blot-1882021143847.jpg)
![Bioactivity IBSP/Sialoprotein II [Unconjugated]](https://images.novusbio.com/images/4014-sp_recombinant-human-ibsp-sialoprotein-ii-protein-cf-bioactivity-4420249391..jpg)
![SDS-PAGE BMP-6 [Unconjugated]](https://images.novusbio.com/images2/BMP-6_507-BP_374.jpg)
![Bioactivity BMP-6 [Unconjugated]](https://images.novusbio.com/images2/BMP-6_507-BP_376.jpg)
![Bioactivity BMP-2 [Unconjugated]](https://images.novusbio.com/images/protein/355-bm_recombinant-human-mouse-rat-bmp-2-protein-bioactivity-181120209742.jpg)
![Western Blot FABP3/H-FABP Antibody (242305) [Unconjugated]](https://images.novusbio.com/images2/FABP3_MAB1678_Western_Blot_5986.jpg)
![Immunohistochemistry FABP3/H-FABP Antibody (242305) [Unconjugated]](https://images.novusbio.com/images2/FABP3_MAB1678_Immunohistochemistry_11974.jpg)
![Simple Western FABP3/H-FABP Antibody (242305) [Unconjugated]](https://images.novusbio.com/images2/FABP3_MAB1678_Simple_Western_20571.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Bioactivity TGF-beta 1 [Unconjugated]](https://images.novusbio.com/images/protein/7754-bhcf_recombinant-human-tgf-beta-1-human-cell-expressed-cf-bioactivity-1811202013946.jpg)
![N/A SLPI [HRP]](https://images.novusbio.com/images2/DATA_SLPI_DPI00_ELISA_792.jpg)
![N/A SLPI [HRP]](https://images.novusbio.com/images2/SLPI_DPI00_ELISA_160.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")