CD35 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the amino acids: VKCQALNKWEPELPSCSRVCQPPPDVLHAERTQRDKDNFSPGQEVFYSCEPGYDLRG |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CR1 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for CD35 Antibody - BSA Free
Background
CD35 encodes a membrane glycoprotein found on peripheral blood cells, glomerular podocytes, and follicular dendritic cells. The protein is a receptor for complement components C3b and C4b and regulates the activity of the complement cascade. Variation in this protein is the basis of the Knops blood group system. The two most common alleles, F and S, differ by 8 exons and are thought to be the result of an unequal crossover event. A secreted form of the protein present in plasma has been described, but its full length nature has not been determined.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Pm, Mu
Applications: ICC/IF, IHC, IHC-P, IP, ISH, WB
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Pm, Mu
Applications: ICC/IF, IHC, IHC-P, IP, ISH, WB
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: ICC, IHC
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
Species: Hu
Applications: B/N, CyTOF-ready, Flow, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow, InhibCellGro, WB
Species: Hu
Applications: IHC, WB
Species: Mu
Applications: IA, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu
Applications: Block, WB
Species: Hu
Applications: Bind
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Neut, WB
Species: Hu
Applications: WB, IHC
Publications for CD35 Antibody (NBP2-13872) (0)
There are no publications for CD35 Antibody (NBP2-13872).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CD35 Antibody (NBP2-13872) (0)
There are no reviews for CD35 Antibody (NBP2-13872).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CD35 Antibody (NBP2-13872) (0)
![Western Blot: CD35 Antibody [NBP2-13872] - Analysis in human tonsil tissue.](http://images.novusbio.com/fullsize/CD35-Antibody-Western-Blot-NBP2-13872-img0004.jpg "Western Blot: CD35 Antibody [NBP2-13872] - Analysis in human tonsil tissue.")
![Immunohistochemistry-Paraffin: CD35 Antibody [NBP2-13872] - Staining of human tonsil shows distinct reticular positivity in germinal center.](http://images.novusbio.com/fullsize/CD35-Antibody-Immunohistochemistry-Paraffin-NBP2-13872-img0001.jpg "Immunohistochemistry-Paraffin: CD35 Antibody [NBP2-13872] - Staining of human tonsil shows distinct reticular positivity in germinal center.")
![Immunohistochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunohistochemistry_6728.jpg)
![Immunocytochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunocytochemistry__Immunofluorescence_23052.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![N/A CD46 Antibody (344519) [Unconjugated]](https://images.novusbio.com/images/antibody/mab2005_human-cd46-mab-clone-344519-209202413163..jpg)
![Immunocytochemistry Integrin beta 2/CD18 Antibody [Unconjugated]](https://images.novusbio.com/images2/Integrin_beta_2_AF1730_Immunocytochemistry_6474.jpg)
![Immunocytochemistry Integrin beta 2/CD18 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af1730_human-integrin-beta-2-cd18-affinity-purified-polyclonal-ab-immunocytochemistry-1292023225343.jpg)
![Flow Cytometry Integrin beta 2/CD18 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af1730_human-integrin-beta-2-cd18-affinity-purified-polyclonal-ab-flow-cytometry-7220258626..jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunohistochemistry Complement Factor H Antibody [Unconjugated]](https://images.novusbio.com/images2/Complement_Factor_H_AF4779_Immunohistochemistry_7182.jpg)
![Western Blot Fc gamma RIII (CD16) Antibody [Unconjugated]](https://images.novusbio.com/images2/Fc_gamma_RIII_AF1597_Western_Blot_23213.jpg)
![SDS-PAGE Fc gamma RIIIA/CD16a [Unconjugated]](https://images.novusbio.com/images2/Fc_gamma_RIIIA_4325-FC_411.jpg)
![Binding Activity Fc gamma RIIIA/CD16a [Unconjugated]](https://images.novusbio.com/images2/Fc_gamma_RIIIA_4325-FC_491.jpg)
![SEC-MALS Fc gamma RIIIA/CD16a [Unconjugated]](https://images.novusbio.com/images/4325-fc_recombinant-human-fc-gamma-riiia-cd16a-protein-cf-sec-mals-2842023172947.jpg)
![Neutralization CX3CL1/Fractalkine Antibody [Unconjugated]](https://images.novusbio.com/images2/CX3CL1_AF365_Block_Neutralize_8860.jpg)
![Western Blot CX3CL1/Fractalkine Antibody [Unconjugated]](https://images.novusbio.com/images/af365_human-cx3cl1-fractalkine-affinity-purified-polyclonal-ab-8120255552865.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")