Note: Mouseover a species abbreviation on the product page to display the fullname.
Images
Western Blot: Odf1 Antibody [NBP2-38050] - Analysis of mouse sperm Odfs or bacterially expressed Odf1-MBP using NBP2-38050 (A) or anti-MBP (B). NIH/3T3 cell lysate serves as negative control. Data from the Independent ...read more
Western Blot: Odf1 Antibody [NBP2-38050] - Analysis of mouse sperm Odfs or bacterially expressed Odf1-MBP using NBP2-38050 (A) or anti-MBP (B). NIH/3T3 cell lysate serves as negative control. Data from the Independent ...read more
Immunocytochemistry/ Immunofluorescence: Odf1 Antibody [NBP2-38050] - Cells were transfected with Odf1 tagged with ECFP (green). NBP2-38050 (red) detects exogenous Odf1 protein. The pictures on the right show the red ...read more
Immunohistochemistry-Paraffin: Odf1 Antibody [NBP2-38050] - Staining of human cerebellum shows no positivity in Purkinje cells as expected.
Immunohistochemistry-Paraffin: Odf1 Antibody [NBP2-38050] - Staining of human testis shows moderate cytoplasmic positivity in mature spermatids.
Immunohistochemistry: Odf1 Antibody [NBP2-38050] - Staining of mouse testicular sections with NBP2-38050 (green, a). DAPI counterstain in blue (b). Merge image in (c). Data from the Independent Validation Initiative at ...read more
Immunohistochemistry-Paraffin: Odf1 Antibody [NBP2-38050] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Odf1 Antibody [NBP2-38050] - Staining of human stomach shows no positivity in glandular cells as expected.
Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!
Or feel free to contact us for alternative products.
Datasheet
Reviews & Publications
Protocols & FAQs
Support & Research
Odf1 Antibody Summary
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RSLERKAIRAIEDEKRELAKLRRTTNRILASSCCSSNILGSVNVCGFEPDQVKVRVKDGKVCVSAERENRYDC
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ODF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
For IHC-Paraffin, HIER pH 6 retrieval is recommended. WB data from the Independent Validation Initiative at antibodies-online.com. Reported ICC-IF application. Data from the Independent Validation Initiative at antibodies-online.com.
Reviewed Applications
Read 3 Reviews rated 5 using NBP2-38050 in the following application:
Reported reactivity in mouse testicular sections. Data from the Independent Validation Initiative at antibodies-online.com.
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for Odf1 Antibody
cancer/testis antigen 133
CT133
HSPB10
MGC129928
MGC129929
ODF
ODF2
ODF27
ODFP
ODFPG
ODFPGA
ODFPGB
outer dense fiber of sperm tails 1
outer dense fiber of sperm tails, 27-kD
outer dense fiber protein 1
outer dense fibre of sperm tails 1
RT7
SODF
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
NBP2-38050 detected proteins within the expected MW range for Odf1 in mouse Odfs (approximately 27kDa) and bacterial extracts containing ODF1-MBP (approximately 70kDa). No protein was detected in the negative control NIH/3T3 lysates.
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: Odf1 Antibody [NBP2-38050] - Analysis of mouse sperm Odfs or bacterially expressed Odf1-MBP using NBP2-38050 (A) or anti-MBP (B). NIH/3T3 cell lysate serves as negative control. Data from the Independent Validation Initiative at antibodies-online.com.](http://images.novusbio.com/fullsize/Odf1-Antibody-Western-Blot-NBP2-38050-img0002.jpg "Western Blot: Odf1 Antibody [NBP2-38050] - Analysis of mouse sperm Odfs or bacterially expressed Odf1-MBP using NBP2-38050 (A) or anti-MBP (B). NIH/3T3 cell lysate serves as negative control. Data from the Independent Validation Initiative at antibodies-online.com.")
![Immunocytochemistry/Immunofluorescence: Odf1 Antibody [NBP2-38050] - Cells were transfected with Odf1 tagged with ECFP (green). NBP2-38050 (red) detects exogenous Odf1 protein. The pictures on the right show the red and green channels merged with DAPI counterstain (blue). Data from the Independent Validation Initiative at antibodies-online.com.](http://images.novusbio.com/fullsize/Odf1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38050-img0004.jpg "Immunocytochemistry/Immunofluorescence: Odf1 Antibody [NBP2-38050] - Cells were transfected with Odf1 tagged with ECFP (green). NBP2-38050 (red) detects exogenous Odf1 protein. The pictures on the right show the red and green channels merged with DAPI counterstain (blue). Data from the Independent Validation Initiative at antibodies-online.com.")
![Immunohistochemistry-Paraffin: Odf1 Antibody [NBP2-38050] - Staining of human cerebellum shows no positivity in Purkinje cells as expected.](http://images.novusbio.com/fullsize/Odf1-Antibody-Immunohistochemistry-Paraffin-NBP2-38050-img0006.jpg "Immunohistochemistry-Paraffin: Odf1 Antibody [NBP2-38050] - Staining of human cerebellum shows no positivity in Purkinje cells as expected.")
![Immunohistochemistry-Paraffin: Odf1 Antibody [NBP2-38050] - Staining of human testis shows moderate cytoplasmic positivity in mature spermatids.](http://images.novusbio.com/fullsize/Odf1-Antibody-Immunohistochemistry-Paraffin-NBP2-38050-img0001.jpg "Immunohistochemistry-Paraffin: Odf1 Antibody [NBP2-38050] - Staining of human testis shows moderate cytoplasmic positivity in mature spermatids.")
![Immunohistochemistry: Odf1 Antibody [NBP2-38050] - Staining of mouse testicular sections with NBP2-38050 (green, a). DAPI counterstain in blue (b). Merge image in (c). Data from the Independent Validation Initiative at antibodies-online.com.](http://images.novusbio.com/fullsize/Odf1-Antibody-Immunohistochemistry-NBP2-38050-img0003.jpg "Immunohistochemistry: Odf1 Antibody [NBP2-38050] - Staining of mouse testicular sections with NBP2-38050 (green, a). DAPI counterstain in blue (b). Merge image in (c). Data from the Independent Validation Initiative at antibodies-online.com.")
![Immunohistochemistry-Paraffin: Odf1 Antibody [NBP2-38050] - Staining of human endometrium shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/Odf1-Antibody-Immunohistochemistry-Paraffin-NBP2-38050-img0005.jpg "Immunohistochemistry-Paraffin: Odf1 Antibody [NBP2-38050] - Staining of human endometrium shows no positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: Odf1 Antibody [NBP2-38050] - Staining of human stomach shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/Odf1-Antibody-Immunohistochemistry-Paraffin-NBP2-38050-img0007.jpg "Immunohistochemistry-Paraffin: Odf1 Antibody [NBP2-38050] - Staining of human stomach shows no positivity in glandular cells as expected.")
![SDS-PAGE TRANCE/TNFSF11/RANK L [Unconjugated]](https://images.novusbio.com/images2/TRANCE_462-TEC_442.jpg)
![Bioactivity TRANCE/TNFSF11/RANK L [Unconjugated]](https://images.novusbio.com/images2/TRANCE_462-TEC_556.jpg)
![N/A Osteoprotegerin/TNFRSF11B [Biotin]](https://images.novusbio.com/images2/DATA_Osteoprotegerin_DY805_ELISA_2238.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot HSP27 [p Ser78, p Ser82, p Ser82] Antibody [Unconjugated]](https://images.novusbio.com/images2/HSP27_AF2314_Western_Blot_5183.jpg)
![Immunocytochemistry HSP27 [p Ser78, p Ser82, p Ser82] Antibody [Unconjugated]](https://images.novusbio.com/images2/HSP27_AF2314_Immunocytochemistry__Immunofluorescence_17269.jpg)
![Western Blot HSP27 [p Ser78, p Ser82, p Ser82] Antibody [Unconjugated]](https://images.novusbio.com/images/af2314_phospho-hsp27-s78-s82-affinity-purified-polyclonal-ab-41202412401253.jpg)
![Immunohistochemistry CD45 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD45_AF114_Immunohistochemistry_23525.jpg)
![Immunocytochemistry CD45 Antibody [Unconjugated]](https://images.novusbio.com/images2/af114_mouse-cd45-affinity-purified-polyclonal-ab-immunocytochemistry-6122021145449.jpg)
![Immunocytochemistry/ Immunofluorescence CD45 Antibody [Unconjugated]](https://images.novusbio.com/images/af114_mouse-cd45-affinity-purified-polyclonal-ab-41202410331954.jpg)
![Western Blot HSPB8/HSP22 Antibody (520817) [Unconjugated]](https://images.novusbio.com/images2/HSPB8_MAB4987_Western_Blot_9457.jpg)
![Immunohistochemistry PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Immunohistochemistry_16650.jpg)
![Western Blot PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Western_Blot_16656.jpg)
![N/A Follistatin [HRP]](https://images.novusbio.com/images2/Follistatin_DFN00_ELISA_97.jpg)
![N/A Follistatin [HRP]](https://images.novusbio.com/images2/DATA_Follistatin_DFN00_ELISA_681.jpg)
![N/A Follistatin [HRP]](https://images.novusbio.com/images2/DATA_Follistatin_DFN00_ELISA_682.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Immunohistochemistry PTHLH/PTHrP Antibody (677939) [Unconjugated]](https://images.novusbio.com/images2/PTHLH_MAB6734_Immunohistochemistry_10816.jpg)
