Anti-E2F1 antibody
| Name | Anti-E2F1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab14768 |
| Prices | $376.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IP WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide: PCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLD , corresponding to amino acids 58-93 of Human E2F1 |
| Description | Rabbit Polyclonal |
| Gene | E2F1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
All lanes : Anti-E2F1 antibody (ab14768) at 1/500 dilutionLane 1 : HeLa cell extract, whole cell lysateLane 2 : HeLa cell extract, nuclear lysateLysates/proteins at 50 µg per lane.SecondaryHRP conjugated goat anti-rabbit antibody